DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox8a

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001271361.1 Gene:sox8a / 102216265 ZFINID:ZDB-GENE-130530-719 Length:401 Species:Danio rerio


Alignment Length:309 Identity:88/309 - (28%)
Similarity:141/309 - (45%) Gaps:69/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 IQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDE 300
            :|.:...:::.|:||||||||||::..|||:|...|.:||:|:||.||..|:||:|.|||||::|
Zfish    74 MQGSRSLKDKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEE 138

  Fly   301 AKRLRAMHMKEHPDYKYRPRR----KPKALRRDGYPYPMPYPSVPVEALRAGITPGYFAPGPTAA 361
            |:|||..|.|::|||||:|||    ||.....:.......:.:.|:....||:          .|
Zfish   139 AERLRLQHKKDYPDYKYQPRRRKSLKPGQNEAEAGAEKNLHHTDPIYKTEAGM----------RA 193

  Fly   362 AYHLGSH----LGQTSTPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDS 422
            .:|...|    .|..:.|||.::.....|.:        ||.:::.:...:.:|.|.|:.....|
Zfish   194 MHHQTIHGVQPHGPPTPPTTPKSDQHQSMKR--------LSENARQNIDFSNVDISELSSDVIGS 250

  Fly   423 KMYQDRAANYAFDISKIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSGGGGSGGGG-------S 480
            ..        .||:                        ::..|.|.|:|...||||.       |
Zfish   251 IS--------QFDV------------------------REFDQYLPLNGHTESGGGQHSSPGCFS 283

  Fly   481 ASSHNNNSSSGLDDRDATPQL-EAVESKPHLHSPSDVGLDYAQYAQQYG 528
            .|.|:::.:|..:....:|.. .|.:.:|.:.:..   |..:.|.|.:|
Zfish   284 TSFHHHSGASAWNKPSGSPSTSSANQQRPLIKTEQ---LSPSHYGQSHG 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 43/70 (61%)
sox8aNP_001271361.1 Sox_N <40..73 CDD:372113
SOX-TCF_HMG-box 85..155 CDD:238684 42/69 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.