DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox15

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001120046.1 Gene:sox15 / 100145022 XenbaseID:XB-GENE-6455809 Length:199 Species:Xenopus tropicalis


Alignment Length:167 Identity:63/167 - (37%)
Similarity:82/167 - (49%) Gaps:53/167 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 IKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEH 312
            :|||||||||||..:|::::..:|||||||||:|||..|:.|.|:|:|||.:|||||||.|..::
 Frog    22 VKRPMNAFMVWSSGERKRMSARHPKMHNSEISRRLGEIWRGLGEDERRPFREEAKRLRAQHAIDY 86

  Fly   313 PDYKYRPRRK-------PKALR------------------------------RDGYPYPMPYPSV 340
            |.|||.||:|       ||...                              :|||.| :|||..
 Frog    87 PGYKYAPRKKRKERGEPPKVAPQAPLPCPPGSSPPRDPQLHPPPPPTHYNGFQDGYGY-LPYPCP 150

  Fly   341 PVEALRAGITPGYFAPGPTAAA-------YHLGSHLG 370
            |        .|..|.|..:..:       |..|.|.|
 Frog   151 P--------RPEPFLPSVSDVSALYGFGLYDYGEHRG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 42/69 (61%)
sox15NP_001120046.1 SOX-TCF_HMG-box 22..91 CDD:238684 41/68 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.