DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21b and sox17b.2

DIOPT Version :9

Sequence 1:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001090837.1 Gene:sox17b.2 / 100038235 XenbaseID:XB-GENE-495335 Length:351 Species:Xenopus tropicalis


Alignment Length:270 Identity:83/270 - (30%)
Similarity:121/270 - (44%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 EEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHM 309
            |..|:|||||||||::.:|:::||.||.:||:|:||.||..||.||...||||:.||:|||..|:
 Frog    33 EARIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVKEAERLRVQHI 97

  Fly   310 KEHPDYKYRPRRKPKALRRD---------------------GYPYPMPYPSVPVEALRAGITP-G 352
            :::||||||||||.:..|.:                     |..|.|.|..  ..:.::.||| |
 Frog    98 QDYPDYKYRPRRKKQVKREEEGFLPSADIPGPQVMGCNAMVGQNYKMQYSG--QNSQQSQITPAG 160

  Fly   353 YFAPGPTAAAYHLGSHL----------GQTSTPTTTQATLSGQMDKFALE-RSSYLSNSSQASAY 406
            ||........|:.|.::          |..|.||      .|:....:.. .|||:.....|||.
 Frog   161 YFEDHNPVGFYYRGYNVPKYYMSQNSSGYCSPPT------QGEYQALSYNFNSSYIPYQQNASAP 219

  Fly   407 SAYLDPSV-----------------LTKAYFDSKMYQDRAANYAFDISKIYGAQQHAAAHHQQQQ 454
            :.....:|                 ::...::.:||....|.    ...:...:||::.|..||.
 Frog   220 AMGKQMAVKENIIQESPEHGIMGCQVSPQMYNGQMYVPECAK----THPVAQTEQHSSLHQSQQM 280

  Fly   455 QQQQQQQQQQ 464
            ..|.....||
 Frog   281 VTQNYLPSQQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 40/70 (57%)
sox17b.2NP_001090837.1 SOX-TCF_HMG-box 35..106 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.