DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and SOX7

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_113627.1 Gene:SOX7 / 83595 HGNCID:18196 Length:388 Species:Homo sapiens


Alignment Length:391 Identity:112/391 - (28%)
Similarity:154/391 - (39%) Gaps:132/391 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PPAAPTPVAPKMHQHTHHHGNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQ 141
            |||.|.|...|                            .|...|:|||||||||::.:|:::|.
Human    29 PPAVPRPPGDK----------------------------GSESRIRRPMNAFMVWAKDERKRLAV 65

  Fly   142 DNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRK--PKTLNKSPV 204
            .||.:||:|:||.||..||.||..||||::|||:|||..||:::|:||||||||  .|.|.|...
Human    66 QNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKKQAKRLCKRVD 130

  Fly   205 PG------------------GGGGGGGGGANGGVNAGGAG--------NSGPSGPGSVGSPKDMQ 243
            ||                  |..|..|...:.|..:.|..        :.||:|.|..|:|..:.
Human   131 PGFLLSSLSRDQNALPEKRSGSRGALGEKEDRGEYSPGTALPSLRGCYHEGPAGGGGGGTPSSVD 195

  Fly   244 ---------PQLSPLGQSLPHL----------HGHPHQSPY-QSHPHHPH--PHPHHVQLAAATL 286
                     |::|||....|..          ||||.:.|: ..||:.|.  |.|.|......:|
Human   196 TYPYGLPTPPEMSPLDVLEPEQTFFSSPCQEEHGHPRRIPHLPGHPYSPEYAPSPLHCSHPLGSL 260

  Fly   287 SAKYGFGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSI----YHPW-------- 339
            :.....|..:...:|..|   |..|:|  .|.....|.:.||| :.|.:    .||.        
Human   261 ALGQSPGVSMMSPVPGCP---PSPAYY--SPATYHPLHSNLQA-HLGQLSPPPEHPGFDALDQLS 319

  Fly   340 --------------RYLPLISPETPPSPPSSSGTGISSYGCVKSEKSSPNAVVASAASPPNIIXP 390
                          :||     .||..|.|::|                 |:..|...|.:.: |
Human   320 QVELLGDMDRNEFDQYL-----NTPGHPDSATG-----------------AMALSGHVPVSQVTP 362

  Fly   391 T 391
            |
Human   363 T 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 40/70 (57%)
SOX7NP_113627.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..46 7/44 (16%)
SOX-TCF_HMG-box 44..115 CDD:238684 40/70 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..197 11/56 (20%)
Sox_C_TAD 198..386 CDD:288887 43/194 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148472
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.