DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and 3xHMG-box2

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:67 Identity:17/67 - (25%)
Similarity:42/67 - (62%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHP 186
            |:|.:::.::|:.:|:|:.::.|..:|:.::..:..:||.|:|.:|:.:..:|.:|...:.||..
plant   380 KKPASSYFLFSKDERKKLTEERPGTNNATVTALISLKWKELSEEEKQVYNGKAAKLMEAYKKEVE 444

  Fly   187 DY 188
            .|
plant   445 AY 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 17/67 (25%)
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 17/67 (25%)
HMG-box_AtHMGB6-like_rpt1 139..206 CDD:438822
HMG-box_AtHMGB6-like_rpt2 255..320 CDD:438823
HMG-box_AtHMGB6-like_rpt3 371..447 CDD:438824 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.