DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and 3xHMG-box1

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_192846.1 Gene:3xHMG-box1 / 826709 AraportID:AT4G11080 Length:446 Species:Arabidopsis thaliana


Alignment Length:91 Identity:23/91 - (25%)
Similarity:46/91 - (50%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 HHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLT 163
            |......|.|.............|:|::|:::::..:|..:..:|..:  .|::|..|.|||.|:
plant   224 HFVQEAEHDNKKKAKKIKDPLKPKQPISAYLIYANERRAALKGENKSV--IEVAKMAGEEWKNLS 286

  Fly   164 EGQKRPFIDEAKRLRALHMKEHPDYK 189
            |.:|.|:...||:.:.::::|...||
plant   287 EEKKAPYDQMAKKNKEIYLQEMEGYK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 20/70 (29%)
3xHMG-box1NP_192846.1 HMGB-UBF_HMG-box 130..193 CDD:238686
HMGB-UBF_HMG-box 246..309 CDD:238686 18/64 (28%)
HMGB-UBF_HMG-box 372..437 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4418
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.