DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and HMGB4

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_179347.1 Gene:HMGB4 / 816263 AraportID:AT2G17560 Length:138 Species:Arabidopsis thaliana


Alignment Length:71 Identity:20/71 - (28%)
Similarity:37/71 - (52%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KRPMNAFMVWSRGQRRKMAQDNPKMHN-SEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEH 185
            |||.:||.|:....|::....||...: :.:.|..||.||.:|:..|.|::.:|:..:..::|..
plant    36 KRPPSAFFVFLEDFRKEFNLANPNNKSVATVGKAAGARWKAMTDEDKAPYVAKAESRKTEYIKNV 100

  Fly   186 PDYKYR 191
            ..|..:
plant   101 QQYNLK 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 20/71 (28%)
HMGB4NP_179347.1 HMG-box_AtHMGB1-like 36..96 CDD:438821 18/59 (31%)

Return to query results.
Submit another query.