DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox12

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001162121.1 Gene:Sox12 / 689988 RGDID:1586313 Length:314 Species:Rattus norvegicus


Alignment Length:169 Identity:72/169 - (42%)
Similarity:87/169 - (51%) Gaps:24/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PPAAPTPVAPKMHQHTHHHGNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQ 141
            ||..|.|.|....:                    .|.......|||||||||||||:.:|||:..
  Rat    16 PPPGPGPAAEGARE--------------------PGWCKTPSGHIKRPMNAFMVWSQHERRKIMD 60

  Fly   142 DNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPK--TLNKSPV 204
            ..|.|||:|||||||..|:||.:.:|.||:.||:|||..||.::||||||||:|.|  .....|.
  Rat    61 QWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPR 125

  Fly   205 PGGGGGGGGGGANGGVNAGGAGNSGPSGP--GSVGSPKD 241
            |.||||||.....|....|..|.....||  |...:|:|
  Rat   126 PPGGGGGGSRLKPGPQLPGRGGRRATGGPLGGGAAAPED 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 44/70 (63%)
Sox12NP_001162121.1 SOX-TCF_HMG-box 39..110 CDD:238684 44/70 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342387
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.