DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and SOX15

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_008873.1 Gene:SOX15 / 6665 HGNCID:11196 Length:233 Species:Homo sapiens


Alignment Length:232 Identity:99/232 - (42%)
Similarity:123/232 - (53%) Gaps:52/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 APTSHSNSNTGSHHNSH------------DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKR 154
            |.|:.::|::|......            :.:|||||||||||..|||:|||.||||||||||||
Human    18 AATAAASSSSGPQEREGAGSPAAPGTLPLEKVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKR 82

  Fly   155 LGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTLNKSPVPGGGGGGGGGGANGG 219
            |||:||||.|.:||||::|||||||.|::::||||||||||.|:....  |...|.|.|..|:||
Human    83 LGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRKAKSSGAG--PSRCGQGRGNLASGG 145

  Fly   220 VNAG----------GAGNSGPSG-----PGSVGSP--KDMQPQLSPLGQSLPHLHG-----HPHQ 262
            ...|          |.|...||.     |||.||.  |...|....|.||.|.|.|     :.|.
Human   146 PLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDPRLQGELLPTYTHY 210

  Fly   263 SPYQSHPHHPHPHPHHVQLAAATLSAKYGFGSPLELS 299
            .|..|      |.|::..||          |:|:.|:
Human   211 LPPGS------PTPYNPPLA----------GAPMPLT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 53/70 (76%)
SOX15NP_008873.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 4/29 (14%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250|UniProtKB:P43267 1..47 4/28 (14%)
SOX-TCF_HMG-box 48..119 CDD:238684 53/70 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..153 19/41 (46%)
Interaction with FHL3. /evidence=ECO:0000250|UniProtKB:P43267 138..183 14/44 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..233 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148482
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.