DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and SOX11

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_003099.1 Gene:SOX11 / 6664 HGNCID:11191 Length:441 Species:Homo sapiens


Alignment Length:390 Identity:111/390 - (28%)
Similarity:156/390 - (40%) Gaps:128/390 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 APTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQ 166
            :|.:...|:......:..|||||||||||||:.:|||:.:.:|.|||:|||||||..||:|.:.:
Human    30 SPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSE 94

  Fly   167 KRPFIDEAKRLRALHMKEHPDYKYRPRRKPK-------TLNKSP---VPGGGGGGGGGGANGG-- 219
            |.|||.||:|||..||.::||||||||:|||       :.::||   ..|||||..||||.|.  
Human    95 KIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKT 159

  Fly   220 --------------------VNAGGAGNSGP---------------SGPGSVGSPK--------- 240
                                ..||.|..||.               ||.|..|:.|         
Human   160 SKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDE 224

  Fly   241 -----DMQPQLSPLGQSLPHLHGHPHQSPYQSHPHHPHPHPHHVQL------AAATLSAKYGFGS 294
                 |...:|               |...:..|......|.|.||      ..:.|..:|    
Human   225 DDDDDDDDDEL---------------QLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRY---- 270

  Fly   295 PLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQA-MY----AGS---------IYHPWRYL--- 342
                          .:|..|..|||:...::...| :|    ||:         :|:.::.:   
Human   271 --------------NVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQ 321

  Fly   343 ---PLISPETPPSPPSSSGTGISSYGCVKSEKSSPNAVVASAASPPNIIXPTPLRFGAGTSSSAE 404
               ||..|...|:...|..|..||        ||.::..:|.....:::....|.|.....|::|
Human   322 HPPPLAQPALSPASSRSVSTSSSS--------SSGSSSGSSGEDADDLMFDLSLNFSQSAHSASE 378

  Fly   405  404
            Human   379  378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 45/70 (64%)
SOX11NP_003099.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SOX-TCF_HMG-box 48..119 CDD:238684 45/70 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..216 30/99 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..292 12/69 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..359 11/47 (23%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q7M6Y2 409..441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148490
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.