Sequence 1: | NP_001261827.1 | Gene: | Sox21a / 39567 | FlyBaseID: | FBgn0036411 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_008872.1 | Gene: | SOX10 / 6663 | HGNCID: | 11190 | Length: | 466 | Species: | Homo sapiens |
Alignment Length: | 335 | Identity: | 107/335 - (31%) |
---|---|---|---|
Similarity: | 138/335 - (41%) | Gaps: | 113/335 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 SHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALH 181
Fly 182 MKEHPDYKYRPRRKPKTLNKSPVPGGGGGGGGGGANGGVNAGGA---------GNSGPSGPGSVG 237
Fly 238 SPKDMQPQLSPLGQSLPHLHGHP-----HQSPYQS----------------HPH----------- 270
Fly 271 -H-------------------PHPHPHHVQLAAATLSAKYGFGSPLE--------LSLPRLPNAF 307
Fly 308 PGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETPP---SPPSSSGTGISS-----Y 364
Fly 365 GCVKSEKSSP 374 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox21a | NP_001261827.1 | SOX-TCF_HMG-box | 120..191 | CDD:238684 | 44/70 (63%) |
SOX10 | NP_008872.1 | Sox_N | 12..93 | CDD:315171 | |
Dimerization (DIM). /evidence=ECO:0000303|PubMed:31194875 | 62..102 | 1/1 (100%) | |||
SOX-TCF_HMG-box | 103..173 | CDD:238684 | 43/69 (62%) | ||
Nuclear export signal | 134..145 | 5/10 (50%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 160..199 | 17/41 (41%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 212..274 | 16/71 (23%) | |||
Transactivation domain (TAM). /evidence=ECO:0000303|PubMed:31194875 | 228..310 | 16/91 (18%) | |||
Transactivation domain (TAC). /evidence=ECO:0000303|PubMed:31194875 | 353..466 | 14/59 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 354..375 | 7/33 (21%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 433..466 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..67 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165148484 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |