DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and SOX9

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_000337.1 Gene:SOX9 / 6662 HGNCID:11204 Length:509 Species:Homo sapiens


Alignment Length:495 Identity:124/495 - (25%)
Similarity:162/495 - (32%) Gaps:176/495 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSISALLHRSHSHSNGYTSSGSSNHSHSSSLSPQLPGINLGLGMVGGLGMGMSVGVGSGSGNTT 65
            |..:...:..:.....|.:.:.|...|..|:.|| .|.                 |.||.:.||.
Human     1 MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSP-CPS-----------------GSGSDTENTR 47

  Fly    66 PP----PMPPADL---------------AVPPA--------APTPVAPKMHQHTHHHGNSHHNAP 103
            |.    |....||               ||...        .|.||         ....|..|.|
Human    48 PQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKGYDWTLVPMPV---------RVNGSSKNKP 103

  Fly   104 TSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKR 168
                            |:||||||||||::..|||:|...|.:||:|:||.||..|:||.|.:||
Human   104 ----------------HVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKR 152

  Fly   169 PFIDEAKRLRALHMKEHPDYKYRPRRKPKTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGPSGP 233
            ||::||:|||..|.|:||||||:|||:...                 .||...|..|.......|
Human   153 PFVEEAERLRVQHKKDHPDYKYQPRRRKSV-----------------KNGQAEAEEATEQTHISP 200

  Fly   234 GSVGSPKDMQPQLSPLGQSLPHLHGHPHQSPYQSHPHHPHPHPHHVQLAAATLSAKYGFGSPL-- 296
            .::..........|..|.|..|..|. |....|..|..|......||...|.|..:   |.||  
Human   201 NAIFKALQADSPHSSSGMSEVHSPGE-HSGQSQGPPTPPTTPKTDVQPGKADLKRE---GRPLPE 261

  Fly   297 ---------------ELS------------------LPRLPNAFPGL----------AHYPLDPT 318
                           |||                  ||  ||..||:          ..|.:..|
Human   262 GGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLP--PNGHPGVPATHGQVTYTGSYGISST 324

  Fly   319 LALDLQARLQAMYAGSIYHPWRYLPLISPETPP-SPPS--------------------------- 355
            .|....       ||.::...:..|...|:.|| :||:                           
Human   325 AATPAS-------AGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTL 382

  Fly   356 ---SSGTGISSYGCVKSEKSSPNAVVASAASPPNIIXPTP 392
               ||..|.|....:|:|:.||:.........|..|..:|
Human   383 TTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAYSP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 43/70 (61%)
SOX9NP_000337.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67 17/83 (20%)
Sox_N 22..94 CDD:403592 20/98 (20%)
Dimerization (DIM). /evidence=ECO:0000305|PubMed:31194875 63..103 7/48 (15%)
PQA. /evidence=ECO:0000305|PubMed:31194875 63..103 7/48 (15%)
SOX-TCF_HMG-box 104..174 CDD:238684 42/69 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..273 35/133 (26%)
Transactivation domain (TAM). /evidence=ECO:0000269|PubMed:31194875 224..307 21/88 (24%)
9aaTAD 1. /evidence=ECO:0000269|PubMed:31194875 275..284 3/8 (38%)
9aaTAD 2. /evidence=ECO:0000269|PubMed:31194875 290..298 0/7 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..415 16/91 (18%)
Transactivation domain (TAC). /evidence=ECO:0000269|PubMed:8640233 394..509 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 479..509
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148448
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.