DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and SOX3

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_005625.2 Gene:SOX3 / 6658 HGNCID:11199 Length:446 Species:Homo sapiens


Alignment Length:391 Identity:134/391 - (34%)
Similarity:161/391 - (41%) Gaps:142/391 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PMPPADLA-----------------VPPAAPT-------PVAPKMHQHTHHHGNSHHNAPTSHSN 108
            |.|||.||                 .|...||       |.||      ...|.|..|| ...:|
Human    61 PSPPATLAHLLPAPAMYSLLETELKNPVGTPTQAAGTGGPAAP------GGAGKSSANA-AGGAN 118

  Fly   109 SNTGSHHNS--------HDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEG 165
            |..||...:        .|.:|||||||||||||||||||.:|||||||||||||||:|||||:.
Human   119 SGGGSSGGASGGGGGTDQDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDA 183

  Fly   166 QKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTL---NKSPVPGGGGGGGGGGANGGVNAGGAGN 227
            :|||||||||||||:||||:||||||||||.|||   :|..:|.|....|...|.....|..|..
Human   184 EKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTKTLLKKDKYSLPSGLLPPGAAAAAAAAAAAAAAA 248

  Fly   228 SGPSGPGSVGSPKDMQPQLSPLGQSLPHLHGHPHQSPYQSHPHHPHPHPHHVQLAAATLSAKYGF 292
            |.|.|   ||...|          :..|::|..:.                   |.:.:..:.|:
Human   249 SSPVG---VGQRLD----------TYTHVNGWANG-------------------AYSLVQEQLGY 281

  Fly   293 GSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETPPS----- 352
            ..|..:|.|..|.|.|.:..|.:                ||..|         ||..||.     
Human   282 AQPPSMSSPPPPPALPPMHRYDM----------------AGLQY---------SPMMPPGAQSYM 321

  Fly   353 ---------------PPSSSGTGISSYG-----------------------CVKSEKSSPNAVVA 379
                           .||::....::||                       .||||.|||...:|
Human   322 NVAAAAAAASGYGGMAPSATAAAAAAYGQQPATAAAAAAAAAAMSLGPMGSVVKSEPSSPPPAIA 386

  Fly   380 S 380
            |
Human   387 S 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 60/70 (86%)
SOX3NP_005625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..140 15/59 (25%)
SOX-TCF_HMG-box 138..209 CDD:238684 60/70 (86%)
SOXp 208..302 CDD:289133 32/125 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148445
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.