DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and SOX1

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_005977.2 Gene:SOX1 / 6656 HGNCID:11189 Length:391 Species:Homo sapiens


Alignment Length:393 Identity:152/393 - (38%)
Similarity:182/393 - (46%) Gaps:89/393 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 MHQHTHHHGNSHHNAPTSHS--------------NSNTGSHHNSHDHIKRPMNAFMVWSRGQRRK 138
            |...|..|......|||:.|              ....|....:.|.:|||||||||||||||||
Human     4 MMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGGGGAKANQDRVKRPMNAFMVWSRGQRRK 68

  Fly   139 MAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTL---N 200
            |||:||||||||||||||||||:::|.:|||||||||||||||||||||||||||||.|||   :
Human    69 MAQENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLLKKD 133

  Fly   201 KSPVPGG----GGGGGG-----------------------GGANGGVNAGGAGNSGPSGPGSVGS 238
            |..:.||    |.||||                       |||.||..|...|.:..:.||||.:
Human   134 KYSLAGGLLAAGAGGGGAAVAMGVGVGVGAAAVGQRLESPGGAAGGGYAHVNGWANGAYPGSVAA 198

  Fly   239 PKD----MQPQLSPLGQSLPHLHG-HPHQSPYQSHPHHPHPHPHHVQ---------LAAATLSAK 289
            ...    ||......||. |...| |||..|...||||||.|||:.|         |..:.:|..
Human   199 AAAAAAMMQEAQLAYGQH-PGAGGAHPHAHPAHPHPHHPHAHPHNPQPMHRYDMGALQYSPISNS 262

  Fly   290 YGFGSPLELSLPRLP-------NAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISP 347
            .|:.|........||       .|..|.||    ...|:...|...|..:|::   .....|:..
Human   263 QGYMSASPSGYGGLPYGAAAAAAAAAGGAH----QNSAVAAAAAAAAASSGAL---GALGSLVKS 320

  Fly   348 E---TPPSP-------PSSSGTGISSYGCVKSEKSSPNAVVASAASPPNIIXPTPLRF---GAGT 399
            |   :||:|       |......||.| ....|...|.|..|:||.  :.:...|..:   |||.
Human   321 EPSGSPPAPAHSRAPCPGDLREMISMY-LPAGEGGDPAAAAAAAAQ--SRLHSLPQHYQGAGAGV 382

  Fly   400 SSS 402
            :.:
Human   383 NGT 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 62/70 (89%)
SOX1NP_005977.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 9/47 (19%)
SOX-TCF_HMG-box 50..121 CDD:238684 62/70 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..249 18/35 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4785
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.