DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox19b

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_571777.1 Gene:sox19b / 64812 ZFINID:ZDB-GENE-010111-1 Length:293 Species:Danio rerio


Alignment Length:283 Identity:116/283 - (40%)
Similarity:140/283 - (49%) Gaps:61/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 HTHHH-----------GNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQDNP 144
            ||..|           ||:||.:.|:     .....:..|.:||||||||||||||||||||:||
Zfish    17 HTLQHSPGMSPPGSGVGNAHHVSKTA-----CPPGVDPMDKVKRPMNAFMVWSRGQRRKMAQENP 76

  Fly   145 KMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTL-------NKS 202
            |||||||||||||||||||:.:|||||||||||||:||||:|||||:||||.|.|       .|.
Zfish    77 KMHNSEISKRLGAEWKLLTDVEKRPFIDEAKRLRAVHMKEYPDYKYKPRRKTKALMKKDNSVGKY 141

  Fly   203 PVPGG-------GGGGGGGGANGGVNAGGAGN-SGPSGPGSVGSPK-----DMQPQLSPLGQSLP 254
            |:..|       ..|.||.....|...|.||. .|..| .::|.|:     |:.....|..|...
Zfish   142 PLAAGNLLASAVAQGQGGSPRMDGYGWGHAGGYMGMQG-DALGYPQQLHRYDLSALQYPAAQPYM 205

  Fly   255 HLHGHPHQSPYQSHPHHPHP-----------H-----PHHVQLA-----AATLSAKYGFGSPLEL 298
            :......|..|.|.|..|.|           |     |:|.:.|     ...:|.....|...|.
Zfish   206 NSASSYSQMSYSSSPQQPSPVMSMVKPEPLSHSPTGVPNHHRGAFQGDLRDMISMYIPGGDTSES 270

  Fly   299 SLPRLPNAFPGLAHYPLDPTLAL 321
            |..|   |:||:..:.|..|:.|
Zfish   271 SNQR---AYPGVQQHYLGGTVPL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 62/70 (89%)
sox19bNP_571777.1 SOX-TCF_HMG-box 52..123 CDD:238684 62/70 (89%)
SOXp 122..203 CDD:289133 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 195 1.000 Inparanoid score I3808
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.