DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and hmgb2a

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001032501.2 Gene:hmgb2a / 641484 ZFINID:ZDB-GENE-051120-126 Length:213 Species:Danio rerio


Alignment Length:111 Identity:31/111 - (27%)
Similarity:49/111 - (44%) Gaps:24/111 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHP 186
            |||.:||.|:....|.|:..|||.:...:|:|:||..|..|:..:|.|:..:|.:|:..:.|:..
Zfish    96 KRPPSAFFVFCSDHRPKVKGDNPGISIGDIAKKLGEMWSKLSPKEKSPYEQKAMKLKEKYEKDVA 160

  Fly   187 DYKYRPRRKPKTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGPSG 232
            .|:.:                      ||...|...||.|.  |:|
Zfish   161 AYRAK----------------------GGKPDGAKKGGPGR--PAG 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 23/75 (31%)
hmgb2aNP_001032501.2 HMG-box_HMGB_rpt1 7..75 CDD:438794
HMG-box_HMGB_rpt2 93..163 CDD:438795 22/66 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.