Sequence 1: | NP_001261827.1 | Gene: | Sox21a / 39567 | FlyBaseID: | FBgn0036411 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021330769.1 | Gene: | sox5 / 567413 | ZFINID: | ZDB-GENE-000607-13 | Length: | 763 | Species: | Danio rerio |
Alignment Length: | 301 | Identity: | 74/301 - (24%) |
---|---|---|---|
Similarity: | 105/301 - (34%) | Gaps: | 140/301 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 SSNHSHSSSLSPQLPGINLGLGMVGGLGMGMSVGVGSGSGN-TTPPPMP------PADLAVPPAA 80
Fly 81 -----PT-PVAPKMHQHTHHHGNSHHNAPTS-------------HSNSNTGSHHNSHD------- 119
Fly 120 ----------------------------------------------------------------- 119
Fly 120 ------------------------------HIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKR 154
Fly 155 LGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRK 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox21a | NP_001261827.1 | SOX-TCF_HMG-box | 120..191 | CDD:238684 | 39/70 (56%) |
sox5 | XP_021330769.1 | SSL_OB | 332..>415 | CDD:332684 | 23/78 (29%) |
SOX-TCF_HMG-box | 561..632 | CDD:238684 | 39/70 (56%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170582395 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |