DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox12

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001025449.1 Gene:sox12 / 562381 ZFINID:ZDB-GENE-040724-33 Length:355 Species:Danio rerio


Alignment Length:287 Identity:90/287 - (31%)
Similarity:125/287 - (43%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 HIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKE 184
            |||||||||||||:.:|||:.:..|.|||:|||||||..||||.:.:|.|||.||:|||..||.:
Zfish    52 HIKRPMNAFMVWSQIERRKIMEQWPDMHNAEISKRLGKRWKLLPDYEKIPFIKEAERLRLKHMAD 116

  Fly   185 HPDYKYRPRRKPK------------TLNKSPVPGGGGGGGGGG-----ANGGVNAGGAGNSGPSG 232
            :||||||||:|.|            ..:..|:||...|....|     |:.......:.|...|.
Zfish   117 YPDYKYRPRKKSKGSTPVKLGEKLPMKSSKPLPGRSSGLSCKGLKIKPASSKHKMNFSSNKYKSY 181

  Fly   233 PGSVGSPKDMQPQL-SPLGQ-----SLPHLHGHPHQSPYQSHPHHPHPHPHHVQLAAATLSAKYG 291
            ..|:.....|...| ||:.|     :..|...| .|:..||....|.|.                
Zfish   182 SESMSDDDTMDVNLESPVTQQDDRNTSSHFVLH-QQATVQSEDQQPIPE---------------- 229

  Fly   292 FGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETPPSPPSS 356
                |.:.:|                   :...:.:|::.:.|....:       ||:..|.|..
Zfish   230 ----LRVKVP-------------------ISQTSSIQSLSSDSECQAF-------PESTTSEPRG 264

  Fly   357 SGTGISSYGCVKSEKSSPNAVVASAAS 383
            |.:|.||    ....:|.:::|:||.|
Zfish   265 STSGRSS----TPTSTSSSSLVSSACS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 46/70 (66%)
sox12NP_001025449.1 SOX-TCF_HMG-box 52..123 CDD:238684 46/70 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.