DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox13

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001352418.1 Gene:sox13 / 555983 ZFINID:ZDB-GENE-100519-1 Length:597 Species:Danio rerio


Alignment Length:110 Identity:50/110 - (45%)
Similarity:67/110 - (60%) Gaps:3/110 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HQHT---HHHGNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSE 150
            |..|   ||..:|......|...|...|...|..||||||||||||::.:||::.|..|.||||.
Zfish   374 HSRTNEDHHSSDSEGQMAISGVGSFGESRTPSSGHIKRPMNAFMVWAKDERRRILQAFPDMHNSS 438

  Fly   151 ISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRK 195
            |||.||:.||.::..:|:|:.:|..||...|::.:|||||:||.|
Zfish   439 ISKILGSRWKSMSNQEKQPYYEEQARLSRQHLERYPDYKYKPRPK 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 37/70 (53%)
sox13NP_001352418.1 SOX-TCF_HMG-box 408..479 CDD:238684 37/70 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.