DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and SOX18

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_060889.1 Gene:SOX18 / 54345 HGNCID:11194 Length:384 Species:Homo sapiens


Alignment Length:314 Identity:91/314 - (28%)
Similarity:131/314 - (41%) Gaps:71/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PADLAVPPAAPTPVAPKMHQHTHHHGNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQ 135
            ||.||.|.|..:|.:|:...........:..:|.........    ....|:|||||||||::.:
Human    39 PAALAAPAAPASPPSPQRSPPRSPEPGRYGLSPAGRGERQAA----DESRIRRPMNAFMVWAKDE 99

  Fly   136 RRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRK----- 195
            |:::||.||.:||:.:||.||..||.|...:||||::||:|||..|:::||:||||||||     
Human   100 RKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHLRDHPNYKYRPRRKKQARK 164

  Fly   196 ----------PKTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGPSGPGSVGSPKDMQP---QLS 247
                      |......|.|                     ...|:..||..:.:::.|   :..
Human   165 ARRLEPGLLLPGLAPPQPPP---------------------EPFPAASGSARAFRELPPLGAEFD 208

  Fly   248 PLGQSLPH---LHG-HPHQSPYQSHPHHPHP---HPHHVQLAAATLSAKYG--FGSPLELSLPRL 303
            .||...|.   |.| .|.::.:...|..|..   .|.....|...||...|  :|:||..:|...
Human   209 GLGLPTPERSPLDGLEPGEAAFFPPPAAPEDCALRPFRAPYAPTELSRDPGGCYGAPLAEALRTA 273

  Fly   304 PNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETPPSPPSSS 357
            |.|.|                  |..:|.|::..|..|...:|| .|.:||..|
Human   274 PPAAP------------------LAGLYYGTLGTPGPYPGPLSP-PPEAPPLES 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 38/70 (54%)
SOX18NP_060889.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 10/52 (19%)
SOX-TCF_HMG-box 84..155 CDD:238684 38/70 (54%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 87..100 9/12 (75%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 111..123 6/11 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..218 20/92 (22%)
Important for transcriptional activation. /evidence=ECO:0000250|UniProtKB:P43680 166..231 13/85 (15%)
Sox_C_TAD 193..382 CDD:288887 33/135 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..312 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148451
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.