DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and cic

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster


Alignment Length:154 Identity:46/154 - (29%)
Similarity:75/154 - (48%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDE 173
            :.|.:...::..|:|||||||::|:..|:.:.:.:|...|..:||.||..|..|...||..:.:.
  Fly  1220 AGTAAGQPANKKIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQKAQYHEL 1284

  Fly   174 AKRLRALHMKEHPDYKYRPRRKPKTLNKSPVPGG---GGGGGGGGANGGVNAGGAGN-------S 228
            |..::..|.|.||::|:..:.:.|:...:..|||   |..|.|......|:..|:.:       |
  Fly  1285 ASSVKDAHFKLHPEWKWCSKDRRKSSTSTATPGGKASGAAGTGDAKQRLVSVDGSDSLEHDMCPS 1349

  Fly   229 GPSGPGSVGS---PKDMQPQLSPL 249
            .|.|.||.|.   ..|:|..:.||
  Fly  1350 TPGGSGSCGGQGISSDLQGDIIPL 1373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 26/78 (33%)
cicNP_001262755.1 DUF4819 349..432 CDD:465014
HMG-box_CIC-like 1231..1308 CDD:438806 26/76 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.