DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox3

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001007502.1 Gene:sox3 / 493228 XenbaseID:XB-GENE-484815 Length:307 Species:Xenopus tropicalis


Alignment Length:301 Identity:113/301 - (37%)
Similarity:144/301 - (47%) Gaps:88/301 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NAPTSHSNSNTGSHHNS---HDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLL 162
            |||.....:..|..:.|   .:.:||||||||||||||||||||:|||||||||||||||:||||
 Frog    17 NAPNGGPGTPGGKGNASIPDQERVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLL 81

  Fly   163 TEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTLNKSPVPGGGGGGGGGGANGGVNAGGAGN 227
            ::.:|||||||||||||:||||:||||||||||.|||.|                         .
 Frog    82 SDSEKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTKTLLK-------------------------K 121

  Fly   228 SGPSGPGSVGSPKDMQPQLSPLGQSL---------PHLHGHPH--------QSPYQSHPHHPHPH 275
            ...|.||::     :.|.:||:..|:         .|::|..:        |..|..||....|.
 Frog   122 DKYSLPGNL-----LAPGVSPVASSVGVGQRIDTYAHMNGWTNGAYSLMQDQLGYSQHPGMNSPQ 181

  Fly   276 PHHVQLAAATLSAKYGFGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWR 340
            ...:|       .:|..|               ||.:.|:..:....:.|      |.|.|.   
 Frog   182 MQQIQ-------HRYDMG---------------GLQYSPMMSSAQTYMNA------AASTYS--- 215

  Fly   341 YLPLISPETPPSPPSSSGTGISSYG-CVKSEKSSPNAVVAS 380
                :||..  :..||:...:.|.| .||||.|||...:.|
 Frog   216 ----MSPAY--NQQSSTVMSLGSMGSVVKSEPSSPPPAITS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 60/70 (86%)
sox3NP_001007502.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 5/23 (22%)
SOX-TCF_HMG-box 39..110 CDD:238684 60/70 (86%)
SOXp 109..189 CDD:372055 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.