DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox2

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_998869.1 Gene:sox2 / 407873 XenbaseID:XB-GENE-484553 Length:311 Species:Xenopus tropicalis


Alignment Length:291 Identity:128/291 - (43%)
Similarity:153/291 - (52%) Gaps:70/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 AP--TSHSNSNTGSHH---NSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKL 161
            ||  .|..|||:||::   ||.|.:||||||||||||||||||||:|||||||||||||||||||
 Frog    13 APQQASGGNSNSGSNNQSKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKL 77

  Fly   162 LTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTL---NKSPVPGGGGGGGGGGANGGVNAG 223
            |:|.:|||||||||||||||||||||||||||||.|||   :|..:|||....|......||.|.
 Frog    78 LSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGANPMTSGVGAS 142

  Fly   224 -GAG-----------NSGPSGPGSVGSPKDMQPQLSPLGQSLPHLHGHPHQSPYQSHPHHPHPHP 276
             |||           |...:|...:     ||.||           |:| |.|..|..:.|...|
 Frog   143 LGAGVNQRMDTYAHMNGWTNGGYGM-----MQEQL-----------GYP-QHPGLSAHNAPQMQP 190

  Fly   277 HH------VQLAAATLSAKYGFGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSI 335
            .|      :|..:.:.|..|..||| ..|:.......||::               |.:|  ||:
 Frog   191 MHRYDVSALQYNSMSSSQTYMNGSP-TYSMSYSQQGAPGMS---------------LGSM--GSV 237

  Fly   336 YHPWRYLPLISPETPPSPPSSSGTGISSYGC 366
                     :..|:..|||..:.:..|...|
 Frog   238 ---------VKSESSSSPPVVTSSSHSRAPC 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 64/70 (91%)
sox2NP_998869.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 12/26 (46%)
SOX-TCF_HMG-box 36..107 CDD:238684 64/70 (91%)
SOXp 106..194 CDD:372055 34/104 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..259 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4714
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm49139
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.