DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox17a

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_989425.1 Gene:sox17a / 395066 XenbaseID:XB-GENE-484295 Length:383 Species:Xenopus tropicalis


Alignment Length:290 Identity:84/290 - (28%)
Similarity:131/290 - (45%) Gaps:61/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SNTGSHHN---SHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPF 170
            |:.||.::   :...|:|||||||||::.:|:::||.||.:||:|:||.||..||.||..:||||
 Frog    46 SDAGSANSRGKAEARIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPF 110

  Fly   171 IDEAKRLRALHMKEHPDYKYRPRRKP--KTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGPSGP 233
            ::||:|||..||::||:|||||||:.  |.:.::                  :.|....:.|...
 Frog   111 VEEAERLRVQHMQDHPNYKYRPRRRKQVKRMKRA------------------DTGFMHMAEPPES 157

  Fly   234 GSVGSPKDMQPQLSPLG---QSLPHL---HGHPHQSPYQSHPHH-----PHPHPHHVQLAAATLS 287
            ..:|:...|..:...||   |:.||.   .|..::.|....||:     |.|....:.||.|.  
 Frog   158 AVLGTDGRMCLESFSLGYHEQTYPHSQLPQGSHYREPQAMAPHYDGYSLPTPESSPLDLAEAD-- 220

  Fly   288 AKYGFGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQA--------------------MYA 332
             ...|.||.:.....:|.::.....:..:...::.::...||                    ||.
 Frog   221 -PVFFTSPPQDECQMMPYSYNASYTHQQNSGASMLVRQMPQAEQMGQGSPVQGMMGCQSSPQMYY 284

  Fly   333 GSIYHP----WRYLPLISPETPPSPPSSSG 358
            |.:|.|    ...||.....:||......|
 Frog   285 GQMYLPGSARHHQLPQAGQNSPPPEAQQMG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 41/70 (59%)
sox17aNP_989425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..58 3/11 (27%)
SOX-TCF_HMG-box 60..131 CDD:238684 41/70 (59%)
Sox17_18_mid 191..239 CDD:371880 12/50 (24%)
Required for transcriptional activity and interaction with ctnnb1. /evidence=ECO:0000250|UniProtKB:Q3KQ35 332..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.