DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox7

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001074219.1 Gene:sox7 / 394203 ZFINID:ZDB-GENE-040109-4 Length:390 Species:Danio rerio


Alignment Length:367 Identity:110/367 - (29%)
Similarity:150/367 - (40%) Gaps:115/367 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWK 160
            ||:  :.|..|::....:...|...|:|||||||||::.:|:::|..||.:||:|:||.||..||
Zfish    20 GNA--DVPDGHTSHRAPADKVSEPRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWK 82

  Fly   161 LLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPK---------------TL----NKSPVPG 206
            .||..||||:::||:|||..||:::|:||||||||.:               ||    |..|.|.
Zfish    83 ALTPPQKRPYVEEAERLRVQHMQDYPNYKYRPRRKKQLKRICKRVDPGFLLTTLGPDQNSLPDPR 147

  Fly   207 G--------------GGGGGGGGANGGV----NAGGAGNSGPSGPGSVGSPKDMQPQLSPLGQSL 253
            |              ||.|..|.|..||    :...:.:|..:.|..:.:|    |::|||... 
Zfish   148 GCCHPLDKDDESGVSGGFGSPGAALPGVRVFRDPASSNSSFDTYPYGLPTP----PEMSPLDAV- 207

  Fly   254 PHLHGHPHQSPYQSH-----------------------------PHHP--------HPHPHHV-- 279
                .|.|||.|.|.                             |:||        |.|..|:  
Zfish   208 ----DHEHQSYYSSSSSVSTSSCSSSNSCPEDRRPTPAHMSSPPPYHPDYSQQAALHSHLGHIPM 268

  Fly   280 --QLAAATLSAKYGFGSPLELSLPRLPNAF-------------PGLAHYP-LDPTLALDLQARLQ 328
              |.:.|||.|    |.||....|..|...             |...|.. ||.....:|...:.
Zfish   269 SHQASGATLIA----GPPLSYYSPSFPQVHIHHQGHLGQLSPPPEQGHLEGLDQLSQAELLGEVD 329

  Fly   329 A----MYAGSI-YHPWRYLPLISPE---TPPSPPSSSGTGIS 362
            .    .|..|. |||.:....::..   ||.|..|||.|..|
Zfish   330 RDEFDQYLNSTSYHPEQGGMTVTGHIQVTPASVCSSSATETS 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 39/70 (56%)
sox7NP_001074219.1 SOX-TCF_HMG-box 42..113 CDD:238684 39/70 (56%)
Sox_C_TAD 174..388 CDD:288887 49/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.