DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox4b

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_957195.1 Gene:sox4b / 393875 ZFINID:ZDB-GENE-040426-1274 Length:342 Species:Danio rerio


Alignment Length:306 Identity:94/306 - (30%)
Similarity:132/306 - (43%) Gaps:73/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 NSHHNAPTSHSNSNTGSHHN------SHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRL 155
            ::|..:|:..|.::.|...|      :..|||||||||||||:.:|||:.:.:|.|||:||||||
Zfish    25 DAHAASPSPGSTASGGEKLNPGWCKTASGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRL 89

  Fly   156 GAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTLNKSPVPGGGGGGGGGGANGGV 220
            |..||||.:|.|.|||.||:|||..||.::||||||||:|.|                       
Zfish    90 GKRWKLLKDGDKIPFIREAERLRLKHMADYPDYKYRPRKKVK----------------------- 131

  Fly   221 NAGGAGNSGPSGPGSVGSPKDMQPQLSPLGQSLPHLHGHPHQSPYQSHPHHPHPHPHHVQLAAAT 285
                :..|.||...|:..|           .|.....|.||:.       .|.|..||     :.
Zfish   132 ----SSGSKPSEKLSISKP-----------SSKKRSAGKPHKK-------EPGPADHH-----SL 169

  Fly   286 LSAKYGFGSPLELSLP----RL----PNAFPGLAHYPLDPTLALD------LQARLQAMYAGSIY 336
            ..||   .:|:....|    ||    .::.|..|..|..|||:..      |.....|..:|...
Zfish   170 YKAK---AAPVVKQSPEKKKRLYIFSSSSSPSPAAVPASPTLSSSADTSDPLSLYEDASGSGKED 231

  Fly   337 HPWRYLPLISPETPPSPPSSSGTGISSYGCVKSEKSSPNAVVASAA 382
            ...||.........|:|.::..:..|.:.....|:...:|:.|:.:
Zfish   232 ADTRYTGSSMRAPSPTPSAAHSSSSSQFSSSSDEEPDDDALDANTS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 47/70 (67%)
sox4bNP_957195.1 SOX-TCF_HMG-box 54..125 CDD:238684 47/70 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.