DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox18

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001019952.1 Gene:Sox18 / 311723 RGDID:1311718 Length:377 Species:Rattus norvegicus


Alignment Length:351 Identity:100/351 - (28%)
Similarity:147/351 - (41%) Gaps:96/351 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GVGSGSGNTTPPPMPPADLA-VPPAAPT--PVAPKMHQHTHHHGNSHHNAPTSHSNSNTGSHHNS 117
            |:|:.:   .|..:|..::: ..||:|:  |.:|.....:..:|.......|:           .
  Rat    25 GLGAAA---EPRGLPVTNVSPTSPASPSSLPRSPPRSPESGRYGFGRGERQTA-----------D 75

  Fly   118 HDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHM 182
            ...|:|||||||||::.:|:::||.||.:||:.:||.||..||.|...:||||::||:|||..|:
  Rat    76 ELRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHL 140

  Fly   183 KEHPDYKYRPRRKP---KTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGPSGP-----GSVGSP 239
            ::||:||||||||.   |.....|              |.:..|....|.|..|     ||..|.
  Rat   141 RDHPNYKYRPRRKKQARKVRRLEP--------------GLLLPGLVQPSAPPEPFAAASGSARSF 191

  Fly   240 KDMQPQLSPL--GQSLPHLHGHPHQSPYQ-----SHPHHPHP------------HPHHVQLAAAT 285
            ::: |.|...  |..||    .|.:||..     .....|.|            .|:..:||.  
  Rat   192 REL-PTLGAEFDGLGLP----TPERSPLDGLESGEASFFPPPLAPEDCALRAFRAPYAPELAR-- 249

  Fly   286 LSAKYGFGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETP 350
             ...:.:||.|..:|...|.|.|                  |..:|.|::..|..:...:||  |
  Rat   250 -DPSFCYGSSLAEALRTAPPAAP------------------LAGLYYGTLGTPGPFPNPLSP--P 293

  Fly   351 PSPPSSSGTGISSYGCVKSEKSSPNA 376
            |..||..||          |:..|.|
  Rat   294 PEAPSLEGT----------EQLEPTA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 38/70 (54%)
Sox18NP_001019952.1 SOX-TCF_HMG-box 78..149 CDD:238684 38/70 (54%)
Sox17_18_mid 191..239 CDD:403331 10/52 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.