DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox21a

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_571361.1 Gene:sox21a / 30543 ZFINID:ZDB-GENE-990715-6 Length:239 Species:Danio rerio


Alignment Length:257 Identity:111/257 - (43%)
Similarity:127/257 - (49%) Gaps:64/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMK 183
            ||:||||||||||||.||||||.|||||||||||||||.|||||::.:|||||||||||||:|||
Zfish     6 DHVKRPMNAFMVWSRAQRRKMALDNPKMHNSEISKRLGGEWKLLSDSEKRPFIDEAKRLRAVHMK 70

  Fly   184 EHPDYKYRPRRKPKTLNKSPVPGGGGGGGGGGANGGVNAG------GAGNSGPSGPGSVGSPKDM 242
            ||||||||||||||.|.|.         .....|...|.|      .|..||.:...|:.:.|..
Zfish    71 EHPDYKYRPRRKPKNLIKK---------DRYHFNVTYNLGEGDPLKSARLSGDALSDSLSAEKTS 126

  Fly   243 QPQLSPLGQSLPHLHGHPH-----QSPYQSHPHHPHPHPHHVQLAAATLSAKYGFGSPLELSLPR 302
            ....:.......||..:|:     .|.....|  |.|.||:..|.       |..|.|       
Zfish   127 VAAAATRVFFSHHLSANPYPFLDLNSKISELP--PAPFPHYSVLG-------YPSGLP------- 175

  Fly   303 LPNAFPGL--------AHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETPPSPPSS 356
               ||||:        ||    |:             |||..|...|..|..|.:.|:.|||
Zfish   176 ---AFPGMGVLAGAPHAH----PS-------------AGSPGHMLPYNCLGWPGSGPAVPSS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 61/70 (87%)
sox21aNP_571361.1 SOX-TCF_HMG-box 7..78 CDD:238684 61/70 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582398
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.