DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox3

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001001811.2 Gene:sox3 / 30529 ZFINID:ZDB-GENE-980526-333 Length:300 Species:Danio rerio


Alignment Length:290 Identity:121/290 - (41%)
Similarity:145/290 - (50%) Gaps:73/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PTSHSNSNTGSHHNS---HDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTE 164
            |.|::.|.||..:||   .|.:||||||||||||||||||||:|||||||||||||||:|||||:
Zfish    14 PQSNTGSVTGGKNNSANDQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLTD 78

  Fly   165 GQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTL---NKSPVPGGGGGGGGGGANGGVNAGGAG 226
            .:|||||||||||||:|||||||||||||||.|||   :|..:|||....|....|..|      
Zfish    79 AEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKTKTLLKKDKYSLPGGLLAPGANAVNNAV------ 137

  Fly   227 NSGPSGPGSVGSPKDMQPQLSPLGQSLPHLHGHPHQSPYQ------SHPHHPHPHPHHVQLAAAT 285
                    |||...|           ..|::|..: |.|.      ::|.||             
Zfish   138 --------SVGQRMD-----------YTHMNGWTN-SAYSLMQDQLAYPQHP------------- 169

  Fly   286 LSAKYGFGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETP 350
                 ...||....:.|...|  || .||:       :......|.|.|.|..      :||...
Zfish   170 -----SMNSPQIQQMHRYDMA--GL-QYPM-------MSTAQTYMNAASTYSS------MSPAYT 213

  Fly   351 PSPPSSSGTGISSYGCVKSEKSSPNAVVAS 380
            ....|:.|.|..:..| |:|.|||...:.|
Zfish   214 QQTSSAMGLGSMASVC-KTEPSSPPPAITS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 62/70 (89%)
sox3NP_001001811.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 8/20 (40%)
SOX-TCF_HMG-box 34..105 CDD:238684 62/70 (89%)
SOXp 104..182 CDD:289133 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582342
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 195 1.000 Inparanoid score I3808
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.