DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox19a

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_570983.2 Gene:sox19a / 30038 ZFINID:ZDB-GENE-980526-102 Length:297 Species:Danio rerio


Alignment Length:228 Identity:101/228 - (44%)
Similarity:124/228 - (54%) Gaps:38/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 AVPPAAPTPVAPKMHQH----THHHGNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQ 135
            ||||.         ||.    |..:|...|.:.....||......:..|.:||||||||||||||
Zfish    12 AVPPT---------HQSAQGMTQLNGGVTHGSAKPAVNSQQQQSSDPMDKVKRPMNAFMVWSRGQ 67

  Fly   136 RRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTLN 200
            ||||||:|||||||||||||||||||||:.:||||||||||||||||||:|||||:||||.|.:.
Zfish    68 RRKMAQENPKMHNSEISKRLGAEWKLLTDAEKRPFIDEAKRLRALHMKEYPDYKYKPRRKTKPVL 132

  Fly   201 KS-------PVPGG----GGGGGGGGANGGVNAGGAGNSGPSGPGSVGSPKDMQPQL-------- 246
            |.       |:..|    .....|.|.:..:::.|.|::| ..||..........||        
Zfish   133 KKDNPAAKYPLSAGNLLAAAAAQGSGGSPRMDSYGWGHTG-GYPGMQTDALGYSQQLHRYDLSAL 196

  Fly   247 ---SPLGQSLPHLHGHPHQSP--YQSHPHHPHP 274
               |.:..:..:::|....:|  |.|.|..|.|
Zfish   197 QYPSAMATAQTYMNGANSYNPMSYSSTPQQPSP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 63/70 (90%)
sox19aNP_570983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 11/48 (23%)
SOX-TCF_HMG-box 52..123 CDD:238684 63/70 (90%)
SOXp 122..>187 CDD:289133 16/65 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..255 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 195 1.000 Inparanoid score I3808
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm25204
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.