DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox7

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001099515.1 Gene:Sox7 / 290317 RGDID:1310038 Length:383 Species:Rattus norvegicus


Alignment Length:363 Identity:115/363 - (31%)
Similarity:147/363 - (40%) Gaps:126/363 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PPAAPTPVAPKMHQHTHHHGNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQ 141
            |||.|.|...|                            .|...|:|||||||||::.:|:::|.
  Rat    29 PPAVPRPSGDK----------------------------GSESRIRRPMNAFMVWAKDERKRLAV 65

  Fly   142 DNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKP--KTLNKSPV 204
            .||.:||:|:||.||..||.||..||||::|||:|||..||:::|:||||||||.  |.|.|...
  Rat    66 QNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKKQGKRLCKRVD 130

  Fly   205 PGG------------------GGGGGGGGANGGVNAGGAGNSG---------PSGPGSV-----G 237
            ||.                  |.|..|...:.|..|.||...|         .:.||||     |
  Rat   131 PGFLLSSLSRDQNTLPEKNSIGRGPLGEKEDRGEYAPGATLPGLHSCYREGAAAAPGSVDTYPYG 195

  Fly   238 SPKDMQPQLSPL----------GQSLPHLHGHPHQSPY-QSHPHHPH--PHPHHVQLAAATLSAK 289
            .|  ..|::|||          ..|....|||||..|: ...|:.|.  |.|.|......:|:..
  Rat   196 LP--TPPEMSPLDALEPEQTFFSSSCQEEHGHPHHLPHLPGPPYSPEFTPSPLHCSHPLGSLALG 258

  Fly   290 YGFGSPLELSLPRLPNAFPGLAHY------PLDPTLALDLQARLQAMYAGSI----YHPW----- 339
            ...|..:..|:|..|   |..|:|      ||.|    :|||.|     |.:    .||.     
  Rat   259 QSPGVSMMSSVPGCP---PSPAYYSHATYHPLHP----NLQAHL-----GQLSPPPEHPGFDTLD 311

  Fly   340 -----------------RYLPLISPETPPSPPSSSGTG 360
                             :||     .||..|.|:||.|
  Rat   312 QLSQVELLGDMDRNEFDQYL-----NTPGHPDSASGVG 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 40/70 (57%)
Sox7NP_001099515.1 SOX-TCF_HMG-box 44..115 CDD:238684 40/70 (57%)
Sox_C_TAD 178..381 CDD:288887 49/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342377
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.