DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox13

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006249824.1 Gene:Sox13 / 289026 RGDID:1309674 Length:613 Species:Rattus norvegicus


Alignment Length:214 Identity:73/214 - (34%)
Similarity:101/214 - (47%) Gaps:38/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISALLHRSHSHSNGYTSSGSSNHSHSS------SLSPQLPGINLGLGMVGGLGMGMSVG------ 56
            :|.|.:.|.|.|....|.|....||.:      |..|.||        :|.||.|.:|.      
  Rat   293 VSELPNTSSSPSLKMNSCGPRPSSHGAPTRDLQSSPPNLP--------LGFLGEGDAVTKAIQDA 349

  Fly    57 ---VGSGSGNTTPPPMPPADLAVPPAAPTPVAPKMHQHTHHHGNSHHNAPTSHSNSN---TGSHH 115
               :.|.||.....|..|....:.....:|...::.::..|        |...:...   .||.|
  Rat   350 RQLLHSHSGALENSPSAPFRKDLISLDSSPAKERLEENCVH--------PLEEAMLGCDVDGSRH 406

  Fly   116 NSH----DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKR 176
            .|.    .||||||||||||::.:|||:.|..|.||||.|||.||:.||.:|..:|:|:.:|..|
  Rat   407 FSESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQAR 471

  Fly   177 LRALHMKEHPDYKYRPRRK 195
            |...|::::|||||:||.|
  Rat   472 LSRQHLEKYPDYKYKPRPK 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 39/70 (56%)
Sox13XP_006249824.1 Herpes_UL46 <251..>419 CDD:355696 33/141 (23%)
SOX-TCF_HMG-box 415..486 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342383
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.