DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and CFAP65

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_011509205.1 Gene:CFAP65 / 255101 HGNCID:25325 Length:1941 Species:Homo sapiens


Alignment Length:323 Identity:61/323 - (18%)
Similarity:93/323 - (28%) Gaps:142/323 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 HHNAP-------TSHSNSNTGSHHNSHDHIKRPMNAFMVW-----SRG-------------QRRK 138
            ||..|       |.||:|...:       |.:|.:  :.|     :||             :.:|
Human   549 HHQDPLFLDLMGTCHSDSTKPA-------ILKPQH--LTWYRTHLARGLTLYPPDILDAMLKEKK 604

  Fly   139 MAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRK-------- 195
            :|||.                    .|.....|.:.:.:.|      |.|.|.|...        
Human   605 LAQDQ--------------------NGALMIPIQDLEDMPA------PQYPYIPPMTEFFFDGTS 643

  Fly   196 -----PKTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGPSGPGSV------------------- 236
                 |..::..||.              |:.|..  .||..|..|                   
Human   644 DITIFPPPISVEPVE--------------VDFGAC--PGPEAPNPVPLCLMNHTKGKIMVVWTRR 692

  Fly   237 -GSPKDMQPQ---LSPLGQSLPHLHGHPHQSPYQSHPHHPHPH-PHHVQLAAATLSAKYGFGSPL 296
             ..|..:.|:   :.||......||..|           |||: .:.|:|.|..:.......|.:
Human   693 SDCPFWVTPESCDVPPLKSMAMRLHFQP-----------PHPNCLYTVELEAFAIYKVLQSYSNI 746

  Fly   297 ELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETPP-SPPSSSG 358
            |             ....:.|:..|.::||..:.:||..:|    :|..|.:.|. .|..|||
Human   747 E-------------EDCTMCPSWCLTVRARGHSYFAGFEHH----IPQYSLDVPKLFPAVSSG 792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 14/88 (16%)
CFAP65XP_011509205.1 ASH <159..>216 CDD:301105
ASH 366..>432 CDD:301105
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.