DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and ste11

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_596656.1 Gene:ste11 / 2540258 PomBaseID:SPBC32C12.02 Length:468 Species:Schizosaccharomyces pombe


Alignment Length:314 Identity:68/314 - (21%)
Similarity:106/314 - (33%) Gaps:91/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFI 171
            |.|.|....:....:|||:|:||::.|.::.::    |..::..||:.:|..|:..:...|:.:.
pombe     2 SASLTAEQKDQKSSVKRPLNSFMLYRRDRQAEI----PTSNHQSISRIIGQLWRNESAQVKKYYS 62

  Fly   172 DEAKRLRALHMKEHPDYKYRP------RRKPKTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGP 230
            |.:...|..||.|:|:|||.|      ||:.|.::                             |
pombe    63 DLSALERQKHMLENPEYKYTPKKRSTVRRRHKKVS-----------------------------P 98

  Fly   231 SGPGSVGSPKDMQPQLSPLGQSLPHLHGHPHQSPYQSHPHHPHPHPHHVQ--LAAATLSAKYGFG 293
            |....|.|...:..|::...::|.           |:.|..|......:.  ||.|....|.|..
pombe    99 SSGSFVASDYVVLQQIAQSSKTLK-----------QTEPEKPVNEEETLAALLAPALSYPKSGKS 152

  Fly   294 SPLELS----LPRLP----NAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETP 350
            :.:|.|    |...|    :..|.|:......|....|....||..:..||:             
pombe   153 NLIETSELSCLSSSPMIRSHTIPSLSFTDQVSTTISTLDKSEQAPSSLGIYY------------- 204

  Fly   351 PSPPSSSGTG------------------ISSYGCVKSEKSSPNAVVASAASPPN 386
            .||.|.|..|                  :||.|||.............|..|.|
pombe   205 RSPSSGSPIGRTKSVCLANKARIVPKRSMSSDGCVDKSYQMSKTPSLEANLPQN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 21/70 (30%)
ste11NP_596656.1 MATA_HMG-box 16..87 CDD:238685 23/74 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.