DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and matmc_2

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_595867.1 Gene:matmc_2 / 2539619 PomBaseID:SPBC23G7.09 Length:181 Species:Schizosaccharomyces pombe


Alignment Length:78 Identity:23/78 - (29%)
Similarity:47/78 - (60%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALH 181
            |.:...||.|||:::.:.:...:.:.||.::||::||.:|..|:..::..:..:...::..:|.|
pombe    99 STERTPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKMSEFYKAQH 163

  Fly   182 MKEHPDYKYRPRR 194
            .|.:|.|||:||:
pombe   164 QKMYPGYKYQPRK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 19/70 (27%)
matmc_2NP_595867.1 MATA_HMG-box 102..178 CDD:238685 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.