Sequence 1: | NP_001261827.1 | Gene: | Sox21a / 39567 | FlyBaseID: | FBgn0036411 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034584.1 | Gene: | Cfap65 / 241116 | MGIID: | 2444274 | Length: | 1847 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 45/199 - (22%) |
---|---|---|---|
Similarity: | 65/199 - (32%) | Gaps: | 66/199 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 242 MQPQLSPL-GQSLPHLHGHPHQSPYQ-SHP-----------HHPHP---------HPHHVQLAAA 284
Fly 285 TLSAKYGFGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPET 349
Fly 350 PPS------PPSS----SGTGISSYGCVKSEKSSPNAVVASAASPPNI-IXPTPLRFGAGTSSSA 403
Fly 404 EHVV 407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox21a | NP_001261827.1 | SOX-TCF_HMG-box | 120..191 | CDD:238684 | |
Cfap65 | NP_001034584.1 | ASH | 288..>354 | CDD:387191 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1668..1721 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167838587 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |