DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Cfap65

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001034584.1 Gene:Cfap65 / 241116 MGIID:2444274 Length:1847 Species:Mus musculus


Alignment Length:199 Identity:45/199 - (22%)
Similarity:65/199 - (32%) Gaps:66/199 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 MQPQLSPL-GQSLPHLHGHPHQSPYQ-SHP-----------HHPHP---------HPHHVQLAAA 284
            ::|....| |::...||     ..|| :||           ||..|         |...::.|..
Mouse   435 IRPAFGTLAGKTRMTLH-----CAYQPTHPIISFRRVACLIHHQDPLFLDLIGTCHSDSIKPAIL 494

  Fly   285 TLSAKYGFGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPET 349
            |         |..|:..|...| .||..||.|...|:..:.:|:....|::..|...||:...|.
Mouse   495 T---------PQHLTWYRTHLA-RGLTLYPPDILAAMLKEKKLERDEDGALILPIESLPMQELED 549

  Fly   350 PPS------PPSS----SGTGISSYGCVKSEKSSPNAVVASAASPPNI-IXPTPLRFGAGTSSSA 403
            .|.      ||.:    .||.                  ..|..||.: :.|..:.|||.....|
Mouse   550 LPDQKYPNIPPMTEYFFDGTR------------------DLAIFPPAVCLEPIDVDFGACPGPEA 596

  Fly   404 EHVV 407
            .:.|
Mouse   597 PNPV 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684
Cfap65NP_001034584.1 ASH 288..>354 CDD:387191
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1668..1721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.