DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox21

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_808421.1 Gene:Sox21 / 223227 MGIID:2654070 Length:276 Species:Mus musculus


Alignment Length:290 Identity:114/290 - (39%)
Similarity:131/290 - (45%) Gaps:92/290 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMK 183
            ||:||||||||||||.|||||||:||||||||||||||||||||||.:|||||||||||||:|||
Mouse     6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK 70

  Fly   184 EHPDYKYRPRRKPKTLNKS-----PVPGG-------------GGGGGGGGANGGV---------- 220
            ||||||||||||||||.|.     |||.|             .|.|...||.||:          
Mouse    71 EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGSVADAEHPALKAGAGLHAGAGGGLVPESLLANPE 135

  Fly   221 ---------------NAGGAGNSGPSGPGSVGSPKDMQPQLSPLGQSLPHLHGHPHQSPYQS--- 267
                           ....|..:..:...:.|||.    .|..||..:..:.......||.|   
Mouse   136 KAAAAAAAAAARVFFPQSAAAAAAAAAAAAAGSPY----SLLDLGSKMAEISSSSSGLPYASSLG 196

  Fly   268 -------------------------HPH-HPHP-HPHHVQLAAATLSAKYGFGSPLELSLPRLPN 305
                                     |.| ||.| :|.::.....:.....|...||...|     
Mouse   197 YPTAGAGAFHGAAAAAAAAAAAAGGHTHSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYIL----- 256

  Fly   306 AFPGLAHYPLDPTLALDLQARLQAMYAGSI 335
             .||:....|||         ..|.||.::
Mouse   257 -LPGMGKPQLDP---------YPAAYAAAL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 64/70 (91%)
Sox21NP_808421.1 SOX-TCF_HMG-box 7..78 CDD:238684 64/70 (91%)
SOXp 77..>95 CDD:403523 11/17 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4760
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm43964
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 1 1.000 - - X1501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.900

Return to query results.
Submit another query.