DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox9

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_035578.3 Gene:Sox9 / 20682 MGIID:98371 Length:507 Species:Mus musculus


Alignment Length:68 Identity:19/68 - (27%)
Similarity:27/68 - (39%) Gaps:19/68 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LNTKVYANSLIGVGIASSLYHASR-------GKLRKY--LRWVDYTMIAT--------TTICLSR 151
            :|..:|.  |||:.....||...|       |..:||  |...|.||...        ||:..::
Mouse    54 INRALYV--LIGITAIGVLYFLVRAVRLKKTGVQKKYGLLSNYDDTMEMAHLESDEDDTTVYEAK 116

  Fly   152 ALR 154
            :||
Mouse   117 SLR 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 14/53 (26%)
Sox9NP_035578.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67 5/14 (36%)
Sox_N 22..94 CDD:463586 12/41 (29%)
Dimerization (DIM). /evidence=ECO:0000250|UniProtKB:P48436 63..103 11/39 (28%)
PQA. /evidence=ECO:0000250|UniProtKB:P48436 63..103 11/39 (28%)
HMG-box_SoxE 104..178 CDD:438840 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..250
Transactivation domain (TAM). /evidence=ECO:0000250|UniProtKB:P48436 224..307
9aaTAD 1. /evidence=ECO:0000250|UniProtKB:P48436 275..284
9aaTAD 2. /evidence=ECO:0000250|UniProtKB:P48436 290..298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..429
Transactivation domain (TAC). /evidence=ECO:0000250|UniProtKB:P48436 392..507
9aaTAD 3. /evidence=ECO:0000250|UniProtKB:P48436 458..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..507
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.