DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox6

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006507560.1 Gene:Sox6 / 20679 MGIID:98368 Length:828 Species:Mus musculus


Alignment Length:80 Identity:42/80 - (52%)
Similarity:61/80 - (76%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 NSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRAL 180
            :|..||||||||||||::.:|||:.|..|.||||.|||.||:.||.::..:|:|:.:|..||..:
Mouse   616 SSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKI 680

  Fly   181 HMKEHPDYKYRPRRK 195
            |::::|:|||:||.|
Mouse   681 HLEKYPNYKYKPRPK 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 41/77 (53%)
Sox6XP_006507560.1 HMG-box_EGL13-like 619..696 CDD:438848 41/77 (53%)

Return to query results.
Submit another query.