DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox6

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006507560.1 Gene:Sox6 / 20679 MGIID:98368 Length:828 Species:Mus musculus


Alignment Length:80 Identity:42/80 - (52%)
Similarity:61/80 - (76%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 NSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRAL 180
            :|..||||||||||||::.:|||:.|..|.||||.|||.||:.||.::..:|:|:.:|..||..:
Mouse   616 SSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKI 680

  Fly   181 HMKEHPDYKYRPRRK 195
            |::::|:|||:||.|
Mouse   681 HLEKYPNYKYKPRPK 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 37/70 (53%)
Sox6XP_006507560.1 SOX-TCF_HMG-box 620..691 CDD:238684 37/70 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838568
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.