DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox18

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_033262.2 Gene:Sox18 / 20672 MGIID:103559 Length:377 Species:Mus musculus


Alignment Length:350 Identity:97/350 - (27%)
Similarity:145/350 - (41%) Gaps:94/350 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GVGS-----GSGNTTPPPMPPADLAVPPAAPTPVAPKMHQHTHHHGNSHHNAPTSHSNSNTGSHH 115
            |:|:     |...|...|..||..:..|.:| |.:|:..::                ....|...
Mouse    25 GIGAAAEARGLPVTNVSPTSPASPSSLPRSP-PRSPESGRY----------------GFGRGERQ 72

  Fly   116 NSHD-HIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRA 179
            .:.: .|:|||||||||::.:|:::||.||.:||:.:||.||..||.|...:||||::||:|||.
Mouse    73 TADELRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRV 137

  Fly   180 LHMKEHPDYKYRPRRK---------------PKTLNKSPVPGGGGGGGGGGAN-GGVNAGGAGNS 228
            .|:::||:||||||||               |..:..|..|.......|...: ..:...||...
Mouse   138 QHLRDHPNYKYRPRRKKQARKVRRLEPGLLLPGLVQPSAPPEAFAAASGSARSFRELPTLGAEFD 202

  Fly   229 GPSGPGSVGSPKDMQPQLSPLGQSLPHLHGHPHQSPYQSHPHHPHP-------HPHHVQLAAATL 286
            |      :|.|   .|:.|||...      .|.::.:...|..|..       .|:..:||.   
Mouse   203 G------LGLP---TPERSPLDGL------EPGEASFFPPPLAPEDCALRAFRAPYAPELAR--- 249

  Fly   287 SAKYGFGSPLELSLPRLPNAFPGLAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPLISPETPP 351
            ...:.:|:||..:|...|.|.|                  |..:|.|::..|..:...:||  ||
Mouse   250 DPSFCYGAPLAEALRTAPPAAP------------------LAGLYYGTLGTPGPFPNPLSP--PP 294

  Fly   352 SPPSSSGTGISSYGCVKSEKSSPNA 376
            ..||..||          |:..|.|
Mouse   295 ESPSLEGT----------EQLEPTA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 38/70 (54%)
Sox18NP_033262.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 12/67 (18%)
SOX-TCF_HMG-box 78..149 CDD:238684 38/70 (54%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 81..94 9/12 (75%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 105..117 6/11 (55%)
Important for transcriptional activation. /evidence=ECO:0000269|PubMed:10742113, ECO:0000269|PubMed:7651823 160..225 14/79 (18%)
Sox_C_TAD 187..375 CDD:288887 36/170 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838565
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.