DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox15

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_033261.1 Gene:Sox15 / 20670 MGIID:98363 Length:231 Species:Mus musculus


Alignment Length:187 Identity:91/187 - (48%)
Similarity:112/187 - (59%) Gaps:24/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMK 183
            :.:|||||||||||..|||:|||.|||||||||||||||:||||.:.:||||::|||||||.|::
Mouse    45 EKVKRPMNAFMVWSSVQRRQMAQQNPKMHNSEISKRLGAQWKLLGDEEKRPFVEEAKRLRARHLR 109

  Fly   184 EHPDYKYRPRRKPKTLNKSPVPGG--GGGGGGGGANGG------VNAGGAGNSGPSG-----PGS 235
            ::||||||||||.|..:...||..  |||...||::.|      ..:.|.|...|:.     |||
Mouse   110 DYPDYKYRPRRKSKNSSTGSVPFSQEGGGLACGGSHWGPGYTTTQGSRGFGYQPPNYSTAYLPGS 174

  Fly   236 VGS----PKDMQPQLSPLGQSLPHLHG--HPHQSPYQSHPHHPHPHPHHVQLAAATL 286
            ..|    |:...|...|  ||.|.|.|  .|..|||.|.....   |::..||.|.:
Mouse   175 YTSSHCRPEAPLPCTFP--QSDPRLQGELRPSFSPYLSPDSST---PYNTSLAGAPM 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 52/70 (74%)
Sox15NP_033261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 91/187 (49%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000269|PubMed:16759287 1..45 91/187 (49%)
SOX-TCF_HMG-box 46..117 CDD:238684 52/70 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..136 13/24 (54%)
Interaction with FHL3. /evidence=ECO:0000269|PubMed:17363903 136..181 13/44 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..231 16/46 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838593
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.