| Sequence 1: | NP_001261827.1 | Gene: | Sox21a / 39567 | FlyBaseID: | FBgn0036411 | Length: | 407 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_035568.1 | Gene: | Sox12 / 20667 | MGIID: | 98360 | Length: | 314 | Species: | Mus musculus |
| Alignment Length: | 233 | Identity: | 82/233 - (35%) |
|---|---|---|---|
| Similarity: | 99/233 - (42%) | Gaps: | 85/233 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 77 PPAAPTPVAPKMHQHTHHHGNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSRGQRRKMAQ 141
Fly 142 DNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRK----PKTLNKS 202
Fly 203 PVPGGGGGG------------GGGGANGGVNAGGAG----------------------------- 226
Fly 227 -------------NSGPSGPG---SVGSP---KDMQPQ 245 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Sox21a | NP_001261827.1 | SOX-TCF_HMG-box | 120..191 | CDD:238684 | 44/70 (63%) |
| Sox12 | NP_035568.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..40 | 6/43 (14%) | |
| SOX-TCF_HMG-box | 39..110 | CDD:238684 | 44/70 (63%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 101..287 | 37/128 (29%) | |||
| Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000269|PubMed:18403418 | 282..314 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167838597 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1275 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR10270 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R685 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.820 | |||||