DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sox10

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_035567.1 Gene:Sox10 / 20665 MGIID:98358 Length:466 Species:Mus musculus


Alignment Length:374 Identity:107/374 - (28%)
Similarity:137/374 - (36%) Gaps:151/374 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALH 181
            |..|:||||||||||::..|||:|...|.:||:|:||.||..|:||.|..|||||:||:|||..|
Mouse   100 SKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQH 164

  Fly   182 MKEHPDYKYRPRRKPK---TLNKSPVPGGGGGGGGGGA-NGGVNAGGAGNSGP--SGPGSVGSPK 240
            .|:||||||:|||:..   ...::..|||....||..| .....:....:..|  ..|.|.|:|:
Mouse   165 KKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGAAAIQAHYKSAHLDHRHPEEGSPMSDGNPE 229

  Fly   241 DMQPQLSPLGQSLPHLHGHP-----HQSPYQS----------------HPH------------H- 271
                  .|.|||    ||.|     .::..||                .||            | 
Mouse   230 ------HPSGQS----HGPPTPPTTPKTELQSGKADPKRDGRSLGEGGKPHIDFGNVDIGEISHE 284

  Fly   272 ------------------PHPHPHHVQLAAATLSAKYGFGSPL---------------------- 296
                              |:.||.||...:|   |.||.||.|                      
Mouse   285 VMSNMETFDVTELDQYLPPNGHPGHVGSYSA---AGYGLGSALAVASGHSAWISKPPGVALPTVS 346

  Fly   297 -----------------------------------ELSLPRLPNAFPGLA--------HYPLDPT 318
                                               .||||...:|||.::        |.|..|.
Mouse   347 PPGVDAKAQVKTETTGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPY 411

  Fly   319 LALDLQARLQAMYAGSIYHPWRYL-----PL---ISPETPPSPPSSSGT 359
            ..       .|..|..:|..:.|:     ||   ||..:|..|.|.|.|
Mouse   412 YG-------HAGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPT 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 44/70 (63%)
Sox10NP_035567.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
Sox_N 12..93 CDD:403592
Dimerization (DIM). /evidence=ECO:0000250|UniProtKB:P56693 62..102 1/1 (100%)
SOX-TCF_HMG-box 103..173 CDD:238684 43/69 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..200 17/39 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..275 16/71 (23%)
Transactivation domain (TAM). /evidence=ECO:0000250|UniProtKB:P56693 228..310 16/91 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..375 0/30 (0%)
Transactivation domain (TAC). /evidence=ECO:0000250|UniProtKB:P56693 353..466 23/108 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..466 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838595
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.