DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox-3

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_510439.1 Gene:sox-3 / 185534 WormBaseID:WBGene00004950 Length:212 Species:Caenorhabditis elegans


Alignment Length:116 Identity:84/116 - (72%)
Similarity:89/116 - (76%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 APTSHSNSNT---------GSH---HNSHDHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKR 154
            |.||:....|         ||.   .||.||:|||||||||||||||||||||||||||||||||
 Worm    17 AKTSYDEDTTSVSSGLSPPGSPVDLQNSLDHVKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKR 81

  Fly   155 LGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTLNKSPVP 205
            ||||||.|:|.:|||||||||||||||||||||||||||||||:.|....|
 Worm    82 LGAEWKQLSEQEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKSSNLKQQP 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 65/70 (93%)
sox-3NP_510439.1 SOX-TCF_HMG-box 47..118 CDD:238684 65/70 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160178
Domainoid 1 1.000 139 1.000 Domainoid score I2973
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - oto20324
orthoMCL 1 0.900 - - OOG6_106862
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 1 1.000 - - X1501
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.680

Return to query results.
Submit another query.