DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and egl-13

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001024918.1 Gene:egl-13 / 180833 WormBaseID:WBGene00001182 Length:470 Species:Caenorhabditis elegans


Alignment Length:274 Identity:82/274 - (29%)
Similarity:116/274 - (42%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TSSGSSNHSHSSSLSPQLPGINLGLGMVGGLGMGMSVGVGSGSGNTTPPPMPPADLAVP--PAAP 81
            |.:|...:..:|::|.....|:..|...|.:.....|.........||.|     .|:|  |.:.
 Worm   217 TIAGHLPNPLASNISLLQKSISAKLAAAGNMQTVEKVETPLNLSKDTPSP-----TAIPQSPLSG 276

  Fly    82 TPVAPKMHQHTHHHGNSHHN-APTSHSNSNTGS------------HHNSHDHIKRPMNAFMVWSR 133
            ..:...:..:....|...:| :|.|...|..|:            ...|.:||||||||||||:|
 Worm   277 FRLPYSLGTNYGSDGQLFNNCSPNSSGKSTPGNTSVTSEVATPRPQAKSPNHIKRPMNAFMVWAR 341

  Fly   134 GQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKP-- 196
            .:|||:.:..|.||||.|||.||:.||.::..:|:|:.:|..||..|||::||||:||||.|.  
 Worm   342 DERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTC 406

  Fly   197 ------------KTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGPSGPGSVGSPKDMQPQLSPL 249
                        ||:.|:......|                     ..|| ...|.|:|..|:..
 Worm   407 VIDGKKVRVNEYKTIMKTKKDLMWG---------------------DEPG-FSQPSDLQMDLASH 449

  Fly   250 GQSLPHLHGHPHQS 263
            ...|..|..|.|||
 Worm   450 VNLLNDLTQHHHQS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 40/70 (57%)
egl-13NP_001024918.1 SOX-TCF_HMG-box 328..399 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.