DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox32

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_571926.1 Gene:sox32 / 116990 ZFINID:ZDB-GENE-011026-1 Length:307 Species:Danio rerio


Alignment Length:230 Identity:58/230 - (25%)
Similarity:103/230 - (44%) Gaps:38/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HQHTHHHGNSHHNAPTSHSNSNTGSHHNS---------HDHIKRPMNAFMVWSRGQRRKMAQDNP 144
            ||:......:|..|....|..:.||..:.         ...::||:|||::|::.:||::||.||
Zfish    29 HQNDEQRRTAHCPASGPLSPVSVGSESSCSSPEAKAPVETRVRRPLNAFIIWTKEERRRLAQLNP 93

  Fly   145 KMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTLNKSPVPGGGG 209
            .:.|:::||.||..||.::...|||::.||:|||..|..::|:|||||||:......|.:|..  
Zfish    94 DLENTDLSKILGKTWKAMSLADKRPYMQEAERLRIQHTIDYPNYKYRPRRRKCNKRSSKMPSS-- 156

  Fly   210 GGGGGGANGGVNAGGAGNSGPSGPGSVGSPK---DMQPQLSPLGQSLPHLHGHPHQSPYQSHPHH 271
                                    .:|.||.   |:...........|:...:.::.|:......
Zfish   157 ------------------------ENVSSPNATFDLSYMFQGQAPQRPYNQINSYRLPHNGFSFE 197

  Fly   272 PHPHPHHVQLAAATLSAKYGFGSPLELSLPRLPNA 306
            .|...:|.:..:::.:..:|..:.:.||...||.:
Zfish   198 NHSSSYHFEATSSSGNVFHGGATSMNLSNVHLPRS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 31/70 (44%)
sox32NP_571926.1 SOX-TCF_HMG-box 69..140 CDD:238684 31/70 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.