DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and LOC103910042

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_009296780.2 Gene:LOC103910042 / 103910042 -ID:- Length:221 Species:Danio rerio


Alignment Length:272 Identity:101/272 - (37%)
Similarity:125/272 - (45%) Gaps:92/272 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DHIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMK 183
            :||||||||||||||||||:||.:||||||||||||||||||.|::.:|||:|||||||||.||:
Zfish    12 EHIKRPMNAFMVWSRGQRRQMALENPKMHNSEISKRLGAEWKRLSDSEKRPYIDEAKRLRAQHMR 76

  Fly   184 EHPDYKYRPRRKPKTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGPSGPGSVGSPKDMQPQLSP 248
            ||||||||||||||.|.:                                      |||...|..
Zfish    77 EHPDYKYRPRRKPKGLLR--------------------------------------KDMVLSLPL 103

  Fly   249 LGQSLPHLHGHPHQSPYQSHPHHPHPHPHHVQLAAATLSA----KYGFGSPLELSLPRLPNAFPG 309
            :|||       ..:.|...|..........|:.:.:|.:.    |.||.:             ..
Zfish   104 VGQS-------DSEKPRDVHSSSAAAQHQFVEQSRSTCTVFPHEKLGFST-------------GS 148

  Fly   310 LAHYPLDPTLALDLQARLQAMYAGSIYHPWRYLPL-ISPETP----------------PSP---- 353
            ||..|     ||..|...::  |||:..|.::... :||..|                |.|    
Zfish   149 LAFSP-----ALGYQGGHRS--AGSLGCPGQFAHTHLSPANPGYLLPCSCSHWSASLSPPPLAYI 206

  Fly   354 --PSSSGTGISS 363
              |..|.:.|:|
Zfish   207 VFPGMSNSAINS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 59/70 (84%)
LOC103910042XP_009296780.2 SOX-TCF_HMG-box 13..84 CDD:238684 59/70 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1501
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.