DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sry3b2

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001396298.1 Gene:Sry3b2 / 103694550 RGDID:9125655 Length:170 Species:Rattus norvegicus


Alignment Length:83 Identity:52/83 - (62%)
Similarity:67/83 - (80%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 HIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKE 184
            |:|||||||||||||:|||:||.||.|.||||||:||.:||.|||.:||||..||:||:.||.::
  Rat     4 HVKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKQLGYQWKSLTEAEKRPFFQEAQRLKTLHREK 68

  Fly   185 HPDYKYRPRRKPKTLNKS 202
            :|:|||:..|:.|...:|
  Rat    69 YPNYKYQTHRRVKVPQRS 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 50/77 (65%)
Sry3b2NP_001396298.1 HMG-box_SoxA_SoxB_SoxG 4..79 CDD:438837 49/74 (66%)

Return to query results.
Submit another query.