DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and Sry4

DIOPT Version :10

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001403684.1 Gene:Sry4 / 103694534 RGDID:9176662 Length:162 Species:Rattus norvegicus


Alignment Length:83 Identity:53/83 - (63%)
Similarity:68/83 - (81%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 HIKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKE 184
            |:|||||||||||||:|||:||.||.|.||||||:||.:||.|||.:||||..||:||:.||.::
  Rat     4 HVKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKQLGYQWKSLTEAEKRPFFQEAQRLKTLHREK 68

  Fly   185 HPDYKYRPRRKPKTLNKS 202
            :|:|||:|.|:.|...:|
  Rat    69 YPNYKYQPHRRVKVSQRS 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 51/77 (66%)
Sry4NP_001403684.1 HMG-box_SoxA_SoxB_SoxG 4..79 CDD:438837 50/74 (68%)

Return to query results.
Submit another query.