DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox21a and sox15

DIOPT Version :9

Sequence 1:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001120046.1 Gene:sox15 / 100145022 XenbaseID:XB-GENE-6455809 Length:199 Species:Xenopus tropicalis


Alignment Length:232 Identity:81/232 - (34%)
Similarity:105/232 - (45%) Gaps:69/232 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 MPPADLAVPPAAPTPVAPKMHQHTHHHGNSHHNAPTSHSNSNTGSHHNSHDHIKRPMNAFMVWSR 133
            |.|...:.|||.|.|                               .|....:|||||||||||.
 Frog     1 MHPPQHSAPPAPPAP-------------------------------PNESPLVKRPMNAFMVWSS 34

  Fly   134 GQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYRPRRK--- 195
            |:|::|:..:|||||||||:|||..|:.|.|.::|||.:|||||||.|..::|.|||.||:|   
 Frog    35 GERKRMSARHPKMHNSEISRRLGEIWRGLGEDERRPFREEAKRLRAQHAIDYPGYKYAPRKKRKE 99

  Fly   196 ----PKTLNKSPVPGGGGGGGGGGANGGVNAGGAGNSGPSGPGSVGSPKDMQPQLSPLGQSLPHL 256
                ||...::|:                         |..||| ..|:|  |||.|   ..|..
 Frog   100 RGEPPKVAPQAPL-------------------------PCPPGS-SPPRD--PQLHP---PPPPT 133

  Fly   257 HGHPHQSPYQSHPHHPHPHPHHVQLAAATLSAKYGFG 293
            |.:..|..|...|:...|.|.....:.:.:||.||||
 Frog   134 HYNGFQDGYGYLPYPCPPRPEPFLPSVSDVSALYGFG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox21aNP_001261827.1 SOX-TCF_HMG-box 120..191 CDD:238684 43/70 (61%)
sox15NP_001120046.1 SOX-TCF_HMG-box 22..91 CDD:238684 42/68 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.